Loading...
Statistics
Advertisement

Angela Mercedes Donna Otto's Portfolio
www.angelaotto.de/

Angelaotto.de

Advertisement
Angelaotto.de is hosted in Germany . Angelaotto.de uses HTTPS protocol. Number of used technologies: 3. First technologies: CSS, Html, Javascript, Number of used javascripts: 2. First javascripts: Pinit.js, Jquery-1.3.2.js, Number of used analytics tools: 1. First analytics tools: Google Analytics, Its server type is: nginx/1.2.1.

Technologies in use by Angelaotto.de

Technology

Number of occurences: 3
  • CSS
  • Html
  • Javascript

Advertisement

Javascripts

Number of occurences: 2
  • pinit.js
  • jquery-1.3.2.js

Analytics

Number of occurences: 1
  • Google Analytics

Server Type

  • nginx/1.2.1

Powered by

  • PHP/5.4.45

Conversion rate optimization

visitors Clickable call number Not founded!
visitors Conversion form (contact form, subcriber) Not founded!
visitors Clickable email Not founded!
visitors CTA (call to action) button Not founded!
visitors List Founded!
visitors Image Not founded!
visitors Enhancement Not founded!
visitors Responsive website Not founded!
visitors Facebook sharing Not founded!
visitors Google+ sharing Not founded!
visitors Twitter sharing Not founded!
visitors Linkedin sharing Not founded!
visitors Blog on the webiste Not founded!

HTTPS (SSL) - Angelaotto.de

SSL certificate

    • name: /OU=Domain Control Validated/OU=PositiveSSL Wildcard/CN=*.serverdomain.org
    • subject:
      • OU:
        • 0: Domain Control Validated
        • 1: PositiveSSL Wildcard
      • CN: *.serverdomain.org
    • hash: cc2d3cc7
    • issuer:
      • C: GB
      • ST: Greater Manchester
      • L: Salford
      • O: COMODO CA Limited
      • CN: COMODO RSA Domain Validation Secure Server CA
    • version: 2
    • serialNumber: 310619339784677510295295113549698689528
    • validFrom: 150617000000Z
    • validTo: 160914235959Z
    • validFrom_time_t: 1434499200
    • validTo_time_t: 1473897599
    • extensions:
      • authorityKeyIdentifier: keyid:90:AF:6A:3A:94:5A:0B:D8:90:EA:12:56:73:DF:43:B4:3A:28:DA:E7
      • subjectKeyIdentifier: 59:D4:F8:B7:81:96:02:8C:B2:3F:29:E1:4E:42:D9:C6:9D:DD:C6:FB
      • keyUsage: Digital Signature, Key Encipherment
      • basicConstraints: CA:FALSE
      • extendedKeyUsage: TLS Web Server Authentication, TLS Web Client Authentication
      • certificatePolicies: Policy: 1.3.6.1.4.1.6449.1.2.2.7 CPS: https://secure.comodo.com/CPS Policy: 2.23.140.1.2.1
      • crlDistributionPoints: Full Name: URI:http://crl.comodoca.com/COMODORSADomainValidationSecureServerCA.crl
      • authorityInfoAccess: CA Issuers - URI:http://crt.comodoca.com/COMODORSADomainValidationSecureServerCA.crt OCSP - URI:http://ocsp.comodoca.com
      • subjectAltName: DNS:*.serverdomain.org, DNS:serverdomain.org

Meta - Angelaotto.de

Number of occurences: 1
  • Name:
    Content: text/html; charset=utf-8

Server / Hosting

  • IP: 89.107.184.29
  • Latitude: 51.30
  • Longitude: 9.49
  • Country: Germany

Rname

  • ns2.nshost2.de
  • ns1.nshost2.de
  • ns3.nshost2.net
  • mail.angelaotto.de

Target

  • hostmaster.webhostone.de

HTTP Header Response

HTTP/1.1 200 OK Server: nginx/1.2.1 Date: Wed, 01 Jun 2016 06:09:33 GMT Content-Type: text/html; charset=utf-8 X-Powered-By: PHP/5.4.45 ETag: "cda0aa2035ef2969c0ba4b77b5bc2782" X-Cache: MISS from s_hk1 X-Cache-Lookup: MISS from s_hk1:80 Via: 1.1 s_hk1 (squid/3.5.9) Connection: keep-alive

DNS

host: angelaotto.de
  1. class: IN
  2. ttl: 3600
  3. type: A
  4. ip: 89.107.184.29
host: angelaotto.de
  1. class: IN
  2. ttl: 3600
  3. type: NS
  4. target: ns2.nshost2.de
host: angelaotto.de
  1. class: IN
  2. ttl: 3600
  3. type: NS
  4. target: ns1.nshost2.de
host: angelaotto.de
  1. class: IN
  2. ttl: 3600
  3. type: NS
  4. target: ns3.nshost2.net
host: angelaotto.de
  1. class: IN
  2. ttl: 3600
  3. type: SOA
  4. mname: ns1.nshost2.de
  5. rname: hostmaster.webhostone.de
  6. serial: 2012082417
  7. refresh: 10800
  8. retry: 3600
  9. expire: 604800
  10. minimum-ttl: 3600
host: angelaotto.de
  1. class: IN
  2. ttl: 3600
  3. type: MX
  4. pri: 10
  5. target: mail.angelaotto.de

Common Typos/Mistakes

This list shows You some spelling mistakes at internet search for this domain.

www.ngelaotto.de, www.aongelaotto.de, www.ongelaotto.de, www.apngelaotto.de, www.pngelaotto.de, www.a9ngelaotto.de, www.9ngelaotto.de, www.angelaotto.de, www.ngelaotto.de, www.aingelaotto.de, www.ingelaotto.de, www.aungelaotto.de, www.ungelaotto.de, www.agelaotto.de, www.anngelaotto.de, www.angelaotto.de, www.anhgelaotto.de, www.ahgelaotto.de, www.anjgelaotto.de, www.ajgelaotto.de, www.ankgelaotto.de, www.akgelaotto.de, www.anlgelaotto.de, www.algelaotto.de, www.an gelaotto.de, www.a gelaotto.de, www.anelaotto.de, www.angselaotto.de, www.anselaotto.de, www.angxelaotto.de, www.anxelaotto.de, www.angyelaotto.de, www.anyelaotto.de, www.anghelaotto.de, www.anhelaotto.de, www.angnelaotto.de, www.annelaotto.de, www.angcelaotto.de, www.ancelaotto.de, www.angdelaotto.de, www.andelaotto.de, www.angeelaotto.de, www.aneelaotto.de, www.angrelaotto.de, www.anrelaotto.de, www.angtelaotto.de, www.antelaotto.de, www.angbelaotto.de, www.anbelaotto.de, www.angvelaotto.de, www.anvelaotto.de, www.anglaotto.de, www.angexlaotto.de, www.angxlaotto.de, www.angeslaotto.de, www.angslaotto.de, www.angewlaotto.de, www.angwlaotto.de, www.angerlaotto.de, www.angrlaotto.de, www.angeflaotto.de, www.angflaotto.de, www.angevlaotto.de, www.angvlaotto.de, www.angeclaotto.de, www.angclaotto.de, www.angeqlaotto.de, www.angqlaotto.de, www.angealaotto.de, www.angalaotto.de, www.angeylaotto.de, www.angylaotto.de, www.angeaotto.de, www.angeluaotto.de, www.angeuaotto.de, www.angel8aotto.de, www.ange8aotto.de, www.angel9aotto.de, www.ange9aotto.de, www.angeljaotto.de, www.angejaotto.de, www.angel0aotto.de, www.ange0aotto.de, www.angelmaotto.de, www.angemaotto.de, www.angelpaotto.de, www.angepaotto.de, www.angeloaotto.de, www.angeoaotto.de, www.angelotto.de, www.angelaootto.de, www.angelootto.de, www.angelapotto.de, www.angelpotto.de, www.angela9otto.de, www.angel9otto.de, www.angelaotto.de, www.angelotto.de, www.angelaiotto.de, www.angeliotto.de, www.angelauotto.de, www.angeluotto.de, www.angelatto.de, www.angelaobtto.de, www.angelabtto.de, www.angelaohtto.de, www.angelahtto.de, www.angelaogtto.de, www.angelagtto.de, www.angelaojtto.de, www.angelajtto.de, www.angelaomtto.de, www.angelamtto.de, www.angelao tto.de, www.angela tto.de, www.angelaovtto.de, www.angelavtto.de, www.angelaoto.de, www.angelaotqto.de, www.angelaoqto.de, www.angelaotato.de, www.angelaoato.de, www.angelaot to.de, www.angelao to.de, www.angelaotwto.de, www.angelaowto.de, www.angelaoteto.de, www.angelaoeto.de, www.angelaotzto.de, www.angelaozto.de, www.angelaotxto.de, www.angelaoxto.de, www.angelaotcto.de, www.angelaocto.de, www.angelaoto.de, www.angelaottqo.de, www.angelaotqo.de, www.angelaottao.de, www.angelaotao.de, www.angelaott o.de, www.angelaot o.de, www.angelaottwo.de, www.angelaotwo.de, www.angelaotteo.de, www.angelaoteo.de, www.angelaottzo.de, www.angelaotzo.de, www.angelaottxo.de, www.angelaotxo.de, www.angelaottco.de, www.angelaotco.de, www.angelaott.de, www.angelaottob.de, www.angelaottb.de, www.angelaottoh.de, www.angelaotth.de, www.angelaottog.de, www.angelaottg.de, www.angelaottoj.de, www.angelaottj.de, www.angelaottom.de, www.angelaottm.de, www.angelaotto .de, www.angelaott .de, www.angelaottov.de, www.angelaottv.de,

Other websites we recently analyzed

  1. Ассоциация служб такси российской федерации
    Nürnberg (Germany) - 88.198.0.162
    Server software: nginx/1.8.1
    Technology: Maxcdn, OSS CDN, CSS, Html, Html5, Javascript, jQuery, Yandex.Metrika
    Number of Javascript: 4
    Number of meta tags: 2
  2. AWAY REALTY | Лучшее агентство зарубежной недвижимости
    HOMES.RU - AWAY REALTY: Элитная зарубежная недвижимость, элитная недвижимость за рубежом, продажа домов за рубежом, квартира, апартаменты, вилла, пентхаус, коттедж, таунхаус, особняк, дача, бунгало, офис, земля, земельный участок, страны мира, Европа, острова, экзотика, правовая информация, визы, описание страны по недвижимости, Австрия, Великобритания, Германия, Испания, Италия, Португалия, Франция, Хорватия, Черногория.
    Netherlands - 109.206.190.54
    Server software: nginx/1.10.1
    Technology: CSS, Html, Html5, Javascript, jQuery, Php, Yandex.Metrika
    Number of Javascript: 4
    Number of meta tags: 5
  3. sariyerevdenevenakliyatfirmalari.com | Isimtescil.net | Ücretsiz yapım aşamasında sayfası
    Cyprus - 93.89.226.17
    Server software: Microsoft-IIS/7.5
    Technology: CSS, Html
  4. Riverlands Equestrian - Welcome
    Riverlands Equestrian Facility
    San Francisco (United States) - 199.34.228.58
    Server software: Apache
    Technology: CSS, Html, Html5, Javascript, Google Analytics, Quantcast Measurement, Webly
    Number of Javascript: 5
    Number of meta tags: 4
  5. Cirurgica Jundiaiense
    This is where the page description goes make sure you change this as it is important for search engines.
    Brazil - 187.17.111.98
    Server software: Apache
    Technology: CSS, Html, Html5, Iframe, Javascript
    Number of Javascript: 7
    Number of meta tags: 3
  6. Welcome to ONLINECHEQUING.COM
    Scottsdale (United States) - 184.168.221.96
    Server software: Microsoft-IIS/7.5
    Technology: Google Adsense, CSS, Html, Javascript
    Number of Javascript: 3
    Number of meta tags: 1
  7. sabaymerlman.com
    Provo (United States) - 50.87.110.109
    Server software: Apache
    Technology: CSS, Font Awesome, Html, Html5, Javascript, jQuery, Php, Pingback, SVG, Wordpress
    Number of Javascript: 8
    Number of meta tags: 3
  8. 本域名出售、转让、出租
    Mesquite (United States) - 23.226.77.61
    Server software: IIS
    Technology: CSS, Html, Javascript
    Number of Javascript: 1
    Number of meta tags: 1
  9. bywx.org
    Portland (United States) - 162.251.5.190
    Server software: Microsoft-IIS/7.0
    Technology: CSS, Html, Php
    Number of Javascript: 1
    Number of meta tags: 1
  10. Routes Educational Institute
    feedBackBox Demo
    India - 103.235.104.148
    Server software: Apache/2.2.29 (Unix) mod_ssl/2.2.29 OpenSSL/1.0.1e-fips mod_bwlimited/1.4
    Technology: CSS, Flexslider, Google Font API, Html, Javascript, jQuery, jQuery UI, Php, SVG
    Number of Javascript: 5
    Number of meta tags: 2

Check Other Websites